PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G107500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 427aa    MW: 44886.2 Da    PI: 6.627
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G107500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  Sobic.006G107500.1.p 14 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding52.79.9e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sobic.006G107500.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.824961IPR017930Myb domain
SuperFamilySSF466897.11E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001671.92E-121661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002495.3E-1667112IPR001005SANT/Myb domain
CDDcd001674.60E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRSPCCEKD GLKKGPWTPE EDQKLLAYIE QHGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DALGTGGGGG PGGAAGAQHA RAAAHLSHTA QWESARLEAE ARLAREARLR  180
ALAASAASAS SSVSAPQPQM PGHAAAHRLD SPTSTLSFSE SAALASVLQE AHGAAAAAAA  240
AARAAMHPMQ AYEVACKEQQ QQWGDHVVDV ADAGFAAAGF TGLLLDGSLS QQDLRPATRN  300
DEDAAEADAG LQETEEEKNY WDSIMNLVNS SSLPTSSVAV PAAEAFPSSA SLPTSMAMPA  360
LEAYSSPASL LTTTVAMPAL EAYSSSSSLQ TSVAMPAPEA YSSSASLSTS VVAVPAPEAY  420
SPALEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849030.0KF184903.1 Saccharum hybrid cultivar R570 clone BAC 121P14 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669319.10.0PREDICTED: uncharacterized protein LOC103646361
TrEMBLA0A096QAS40.0A0A096QAS4_MAIZE; Uncharacterized protein
STRINGGRMZM2G032655_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.26e-90myb domain protein 16